DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctso

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_808330.1 Gene:Ctso / 229445 MGIID:2139628 Length:312 Species:Mus musculus


Alignment Length:334 Identity:86/334 - (25%)
Similarity:131/334 - (39%) Gaps:80/334 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AKTWTVGRNFDASVTEGHIRR--------------LMGVHPDAHKFALPDKREVLGDLY------ 80
            |.||:.....:|:.....:.|              ..||:..::.|....|...||..|      
Mouse    22 AGTWSWSHQREAAALRESLHRHRYLNSFPHENSTAFYGVNQFSYLFPEEFKALYLGSKYAWAPRY 86

  Fly    81 -------VNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNF 138
                   :.:| .||..||    |.:...:..:|:|..||.||||..|.|:.....|.  ||...
Mouse    87 PAEGQRPIPNV-SLPLRFD----WRDKHVVNPVRNQEMCGGCWAFSVVSAIESARAIQ--GKSLD 144

  Fly   139 HFSADDLVSCCHTCGFGCNGGFPGAA--WSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTR 201
            :.|...::.|... ..||.||.|..|  |...|:..:|:...|       |::.      |||  
Mouse   145 YLSVQQVIDCSFN-NSGCLGGSPLCALRWLNETQLKLVADSQY-------PFKA------VNG-- 193

  Fly   202 PPCAHGGRTPKCSHVCQS--GYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYED 264
                      :|.|..||  |.:|     |.|  .:|:.|....|:...:::.||:    .|..|
Mouse   194 ----------QCRHFPQSQAGVSV-----KDF--SAYNFRGQEDEMARALLSFGPL----VVIVD 237

  Fly   265 LILYKD---GVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH 326
            .:.::|   |:.||........||:.|.|:...|  ..|||::.|||.:.||..|:..:..|.:.
Mouse   238 AMSWQDYLGGIIQHHCSSGEANHAVLITGFDRTG--NTPYWMVRNSWGSSWGVEGYAHVKMGGNV 300

  Fly   327 CGIESSISA 335
            |||..|::|
Mouse   301 CGIADSVAA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/41 (17%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/255 (28%)
CtsoNP_808330.1 Peptidase_C1A 100..305 CDD:239068 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.