DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Y71H2AR.2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001367938.1 Gene:Y71H2AR.2 / 190615 WormBaseID:WBGene00022189 Length:299 Species:Caenorhabditis elegans


Alignment Length:256 Identity:65/256 - (25%)
Similarity:99/256 - (38%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC 148
            :|...|||   ..|.....:|.::|||.|.:..||....::.......:.|.: ..||...|:.|
 Worm    78 MDRTTEEF---LDWREKGIVGPVKDQGKCNASHAFAITSSIESMYAKATNGTL-LSFSEQQLIDC 138

  Fly   149 CHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKC 213
            ......||...|...|..|....||.:...|       ||        |:.|...|         
 Worm   139 NDQGYKGCEEQFAMNAIGYLATHGIETEADY-------PY--------VDKTNEKC--------- 179

  Fly   214 SHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEI-MTN-GPVEGAFTVYEDLILYKDGVYQHE 276
                    |.|..|.|....|......|  |:..:: :|| ||..........|..||.|:|...
 Worm   180 --------TFDSTKSKIHLKKGVVAEGN--EVLGKVYVTNYGPAFFTMRAPPSLYDYKIGIYNPS 234

  Fly   277 HGKELGGHAIR---ILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS 334
            ..:....|.||   |:|:|:.||:|  ||::..|:.|.||:.|:.::.|..:.|.:.::|:
 Worm   235 IEECTSTHEIRSMVIVGYGIEGEQK--YWIVKGSFGTSWGEQGYMKLARDVNACAMATTIA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 64/252 (25%)
Y71H2AR.2NP_001367938.1 Peptidase_C1A 84..290 CDD:239068 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.