powered by:
Protein Alignment CtsB1 and Y71H2AM.3
DIOPT Version :9
Sequence 1: | NP_001259536.2 |
Gene: | CtsB1 / 32341 |
FlyBaseID: | FBgn0030521 |
Length: | 340 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497622.2 |
Gene: | Y71H2AM.3 / 190606 |
WormBaseID: | WBGene00022168 |
Length: | 483 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 10/34 - (29%) |
Similarity: | 16/34 - (47%) |
Gaps: | 12/34 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 PDAHKFA-----------LPDKREVLGDLYVNSV 84
||.||.. ||::::|:.. |.||:
Worm 249 PDRHKNVKREELKANPKWLPNEKKVMIS-YANSI 281
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.