DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and K02E7.10

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_493904.1 Gene:K02E7.10 / 186889 WormBaseID:WBGene00019314 Length:299 Species:Caenorhabditis elegans


Alignment Length:259 Identity:58/259 - (22%)
Similarity:95/259 - (36%) Gaps:74/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 WPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFP 161
            |.....:|.::|||.|.:.:||.|:.|:.......:.||: ..||...::.|.:.          
 Worm    86 WREKGIVGPVKDQGKCNASYAFAAIAAIESMYAKANNGKL-LSFSEQQIIDCANF---------- 139

  Fly   162 GAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVN-------------GTRPPCAHGGR--TP 211
                                        .:||:.::.             ||.....:.|:  ..
 Worm   140 ----------------------------TNPCQENLENVLSNRFLKENGVGTEADYPYVGKENVG 176

  Fly   212 KCSHVCQSGYTVDYAKDKHFGSKSY-SVRRNVREIQEEIMTNGPVEGAFTVYE--DLILYKDGVY 273
            ||          :|...|.....:| .|..|....:..|.|.|  .|.|.:..  ....||.|:|
 Worm   177 KC----------EYDSSKMKLRPTYIDVYPNEEWARAHITTFG--TGYFRMRSPPSFFHYKTGIY 229

  Fly   274 ---QHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS 334
               :.|.|......::.|:|:|..|.||  ||::..|:.|.||:||:.::.|..:.||:..|||
 Worm   230 NPTKEECGNANEARSLAIVGYGKDGAEK--YWIVKGSFGTSWGEHGYMKLARNVNACGMAESIS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 58/259 (22%)
K02E7.10NP_493904.1 Peptidase_C1A 82..293 CDD:239068 58/259 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.