DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and C32B5.13

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 / 183116 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans


Alignment Length:136 Identity:33/136 - (24%)
Similarity:54/136 - (39%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SPCEHHV--------NGTRPPCAH---GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVRE 244
            |||:.::        ||......:   |....||.:        |..|.|.:.:....| .|:.|
 Worm    26 SPCQENILSHEFIKKNGVVTEADYPYVGKENEKCKY--------DENKIKLWPTNMLLV-GNLPE 81

  Fly   245 --IQEEIMTNGPVEGAFTVYEDLILYKDGVY---QHEHGKELGGHAIRILGWGVWGEEKIPYWLI 304
              ::..|..:||.............||.|:|   |.|.||.....::.|:|:|:.|.:.  ||::
 Worm    82 TLLKLFIKEHGPGYFRMKAPPSFFNYKTGIYSPTQEECGKATDARSLTIVGYGIEGGQN--YWIV 144

  Fly   305 GNSWNT 310
            ..|:.|
 Worm   145 KGSFGT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 33/136 (24%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:390061 32/134 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.