DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and R09F10.1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_509408.1 Gene:R09F10.1 / 181087 WormBaseID:WBGene00019986 Length:383 Species:Caenorhabditis elegans


Alignment Length:308 Identity:77/308 - (25%)
Similarity:121/308 - (39%) Gaps:78/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KFALPDKREVLGDLYVNSVDELPEE---------------FDSRK----------------QWPN 99
            :|...::|.:..||.||...:..:|               ||:.|                .|..
 Worm   112 EFEAEEERNLGLDLDVNEFTDWTDEELQKMVQENKYTKYDFDTPKFEGSYLETGVIRPASIDWRE 176

  Fly   100 CPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAA 164
            ...:..|::||.|||||||..|.::..:..|..|..|:  .|..::|. |.....||:||:...|
 Worm   177 QGKLTPIKNQGQCGSCWAFATVASVEAQNAIKKGKLVS--LSEQEMVD-CDGRNNGCSGGYRPYA 238

  Fly   165 WSYWTRKGIVSGGPYGSNQGCRPYEI---SPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYA 226
            ..:....|:.|...|       ||..   ..|....|.||.                  :..|:.
 Worm   239 MKFVKENGLESEKEY-------PYSALKHDQCFLKENDTRV------------------FIDDFR 278

  Fly   227 KDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHE----HGKELGGHAIR 287
                      .:..|..:|...:.|.|||.....|.:.:..|:.|::...    ..|.:|.||:.
 Worm   279 ----------MLSNNEEDIANWVGTKGPVTFGMNVVKAMYSYRSGIFNPSVEDCTEKSMGAHALT 333

  Fly   288 ILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISA 335
            |:|:|  ||.:..||::.|||.|.||..|:||:.||.:.||:.:::.|
 Worm   334 IIGYG--GEGESAYWIVKNSWGTSWGASGYFRLARGVNSCGLANTVVA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/286 (25%)
R09F10.1NP_509408.1 Inhibitor_I29 82..138 CDD:285458 7/25 (28%)
Peptidase_C1 169..381 CDD:278538 67/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.