DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and cpz-2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_506318.1 Gene:cpz-2 / 179818 WormBaseID:WBGene00000789 Length:467 Species:Caenorhabditis elegans


Alignment Length:272 Identity:80/272 - (29%)
Similarity:111/272 - (40%) Gaps:64/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DELPEEFDSRKQWPN------C-PTIGEIRDQG---SCGSCWAFGAVEAMSDRVCIHSGGKVNF- 138
            ::||..:|    |.|      | ||    |:|.   .|||||.||...|::||..:...|:... 
 Worm   219 NDLPTGWD----WRNVSGVNYCSPT----RNQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMT 275

  Fly   139 HFSADDLVSCCHTCGFG-CNGGFPGAAWSYWTRKGIVSGG--PYGSNQG-CRPYEISPCEHHVNG 199
            ..|..:::.|   .|.| |.||..|....:...:|:|..|  .|.:..| |.||      |....
 Worm   276 QLSPQEIIDC---NGKGNCQGGEIGNVLEHAKIQGLVEEGCNVYRATNGECNPY------HRCGS 331

  Fly   200 TRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE---GAFTV 261
            ..|        .:|..:  :.||..|.||       |...:...:|..||...||:.   ||...
 Worm   332 CWP--------NECFSL--TNYTRYYVKD-------YGQVQGRDKIMSEIKKGGPIACAIGATKK 379

  Fly   262 YEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG--- 323
            :|  ..|..|||..:...| ..|.|.:.|||| .|..:.||:..|||...||:.|:||::..   
 Worm   380 FE--YEYVKGVYSEKSDLE-SNHIISLTGWGV-DENGVEYWIARNSWGEAWGELGWFRVVTSKFK 440

  Fly   324 -----QDHCGIE 330
                 |.:.|||
 Worm   441 DGQGDQYNMGIE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 79/269 (29%)
cpz-2NP_506318.1 Peptidase_C1A_CathepsinX 221..461 CDD:239149 80/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.