DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and tag-196

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_505215.2 Gene:tag-196 / 179240 WormBaseID:WBGene00007055 Length:477 Species:Caenorhabditis elegans


Alignment Length:266 Identity:71/266 - (26%)
Similarity:119/266 - (44%) Gaps:52/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSA 142
            |:.:|. ::|||.||    |.....:.::::||:|||||||.....:.....|.....|:  .|.
 Worm   256 DVTINE-EDLPESFD----WREKGAVTQVKNQGNCGSCWAFSTTGNVEGAWFIAKNKLVS--LSE 313

  Fly   143 DDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHG 207
            .:||. |.:...|||||.|..|:....|.|           |..|.:..|             :.
 Worm   314 QELVD-CDSMDQGCNGGLPSNAYKEIIRMG-----------GLEPEDAYP-------------YD 353

  Fly   208 GRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGV 272
            ||...| |:.:....|       :.:.|..:..:..|:|:.::|.||:...... ..|..|:.||
 Worm   354 GRGETC-HLVRKDIAV-------YINGSVELPHDEVEMQKWLVTKGPISIGLNA-NTLQFYRHGV 409

  Fly   273 YQHEHGKELG------GHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIES 331
            .   |..::.      .|.:.|:|:|..|.:  |||::.|||..:||:.|:|::.||::.||::.
 Worm   410 V---HPFKIFCEPFMLNHGVLIVGYGKDGRK--PYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQE 469

  Fly   332 SISAGL 337
            ..::.|
 Worm   470 MATSAL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 67/253 (26%)
tag-196NP_505215.2 CY 23..>91 CDD:298856
Inhibitor_I29 174..231 CDD:285458
Peptidase_C1 264..475 CDD:278538 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.