DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and F26E4.3

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_492593.2 Gene:F26E4.3 / 172827 WormBaseID:WBGene00009158 Length:452 Species:Caenorhabditis elegans


Alignment Length:334 Identity:115/334 - (34%)
Similarity:166/334 - (49%) Gaps:48/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GEPSLLSDEFIEVVRSKAKTWTVGRNFDA----SVTEGHIRRLMGVHPDAHKFALPDKREVLGDL 79
            |...|:..:.:|.:.:...:|: .||:.|    |:::|...||..:.|:.   ::.:..|:|   
 Worm   121 GTACLIQPDILEKIHTGRYSWS-ARNYSAFWGRSLSDGIKYRLGTLFPER---SVQNMNEIL--- 178

  Fly    80 YVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADD 144
              ....||||.||:|.:|.  |.|..:.|||.|||.|:.......|||:.|.|.|::|...|:..
 Worm   179 --IKPRELPEHFDARDKWG--PLIHPVADQGDCGSSWSVSTTAISSDRLAIISEGRINSTLSSQQ 239

  Fly   145 LVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGG--PYGSNQGCRP-YEISPCEHHVN--GTRPPC 204
            |:||......||.||:...||.|..:.|:|...  ||.|.|...| :.:.|...:.|  |.|   
 Worm   240 LLSCNQHRQKGCEGGYLDRAWWYIRKLGVVGDHCYPYVSGQSREPGHCLIPKRDYTNRQGLR--- 301

  Fly   205 AHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYK 269
                        |.|| :.|....|.  :..|.|.....:||.|:||||||:..|.|:||..:|.
 Worm   302 ------------CPSG-SQDSTAFKM--TPPYKVSSREEDIQTELMTNGPVQATFVVHEDFFMYA 351

  Fly   270 DGVYQH-----EHGKEL---GGHAIRILGWGVWGE--EKIPYWLIGNSWNTDWGDHGFFRILRGQ 324
            .|||||     :.|...   |.|::|:|||||...  :.|.|||..|||.|.||:.|:|::|||:
 Worm   352 GGVYQHSDLAAQKGASSVAEGYHSVRVLGWGVDHSTGKPIKYWLCANSWGTQWGEDGYFKVLRGE 416

  Fly   325 DHCGIESSI 333
            :||.|||.:
 Worm   417 NHCEIESFV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/43 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 99/261 (38%)
F26E4.3NP_492593.2 Somatomedin_B 37..82 CDD:279385
Peptidase_C1A_CathepsinB 185..428 CDD:239111 99/261 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.