DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and cpz-1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_491023.2 Gene:cpz-1 / 171829 WormBaseID:WBGene00000788 Length:306 Species:Caenorhabditis elegans


Alignment Length:257 Identity:70/257 - (27%)
Similarity:106/257 - (41%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EEFDSRKQWPNCPTIGEIRDQGS---------------CGSCWAFGAVEAMSDRVCI-HSGGKVN 137
            |:|||.    :.|...:.||...               |||||||||..|::||:.| .......
 Worm    58 EDFDSE----DLPKTWDWRDANGINYASADRNQHIPQYCGSCWAFGATSALADRINIKRKNAWPQ 118

  Fly   138 FHFSADDLVSC--CHTCGFGCNGGFPGAAWSYWTRKGI--VSGGPYGSNQG-CRPYEISPCEHHV 197
            .:.|..:::.|  ..||   ..||.||..:.|....||  .:...|.:..| |.||  :.|    
 Worm   119 AYLSVQEVIDCSGAGTC---VMGGEPGGVYKYAHEHGIPHETCNNYQARDGKCDPY--NRC---- 174

  Fly   198 NGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVY 262
             |:   |..|    :|..:  ..||:       :....|.......:::.||...||:.......
 Worm   175 -GS---CWPG----ECFSI--KNYTL-------YKVSEYGTVHGYEKMKAEIYHKGPIACGIAAT 222

  Fly   263 EDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQ 324
            :....|..|:|:....::: .|.|.:.||||..|..:.||:..|||...||:||:|:|:..|
 Worm   223 KAFETYAGGIYKEVTDEDI-DHIISVHGWGVDHESGVEYWIGRNSWGEPWGEHGWFKIVTSQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/257 (27%)
cpz-1NP_491023.2 Peptidase_C1A_CathepsinX 65..305 CDD:239149 66/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.