DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSW

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:401 Identity:87/401 - (21%)
Similarity:134/401 - (33%) Gaps:139/401 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AASVAALTSG------------EPSLLSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHP 62
            |..||.|..|            :|..|.:.|        |.:.:..|......|.|..||     
Human    12 ALLVAGLAQGIRGPLRAQDLGPQPLELKEAF--------KLFQIQFNRSYLSPEEHAHRL----- 63

  Fly    63 D--AHKFALPDK--------------------REVLGDLY-----VNSVDELPEEFDSRKQWPNC 100
            |  ||..|...:                    .|..|.||     ...|..:..|..|.:...:.
Human    64 DIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESV 128

  Fly   101 P----------TIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNF----HFSADDLVSC 148
            |          .|..|:||.:|..|||.   |.:|.:         .:::|    ..|..:|:. 
Human   129 PFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNIETL---------WRISFWDFVDVSVQELLD- 183

  Fly   149 CHTCGFGCNGGFPGAAWSYW----TRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGR 209
            |..||.||:|||   .|..:    ...|:.|...|......|.:...|.::.             
Human   184 CGRCGDGCHGGF---VWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQ------------- 232

  Fly   210 TPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQ 274
                        .|.:.:|      ...::.|...|.:.:.|.||:.....: :.|.||:.||.:
Human   233 ------------KVAWIQD------FIMLQNNEHRIAQYLATYGPITVTINM-KPLQLYRKGVIK 278

  Fly   275 HEH---GKELGGHAIRILGW-------GVWGE-----------EKIPYWLIGNSWNTDWGDHGFF 318
            ...   ..:|..|::.::|:       |:|.|           ...|||::.|||...||:.|:|
Human   279 ATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYF 343

  Fly   319 RILRGQDHCGI 329
            |:.||.:.|||
Human   344 RLHRGSNTCGI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 9/41 (22%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 64/284 (23%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 11/68 (16%)
Peptidase_C1A 129..358 CDD:239068 62/271 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.