DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSS

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_004070.3 Gene:CTSS / 1520 HGNCID:2545 Length:331 Species:Homo sapiens


Alignment Length:305 Identity:88/305 - (28%)
Similarity:138/305 - (45%) Gaps:63/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPD--KREVLGDLYVNSVDELPEEFDSRKQWPNC 100
            ::.:|.|....:|...:..||.      ...:|.  :|.:......|.:  ||:..|.|::  .|
Human    72 SYDLGMNHLGDMTSEEVMSLMS------SLRVPSQWQRNITYKSNPNRI--LPDSVDWREK--GC 126

  Fly   101 PTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGF---GCNGGFPG 162
            .|  |::.|||||:||||.||.|:..::.:.:|..|:  .||.:||. |.|..:   ||||||..
Human   127 VT--EVKYQGSCGACWAFSAVGALEAQLKLKTGKLVS--LSAQNLVD-CSTEKYGNKGCNGGFMT 186

  Fly   163 AAWSY-WTRKGIVSGGPYGSNQGCRPYEI--SPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVD 224
            .|:.| ...|||.|...|       ||:.  ..|::........|              |.||  
Human   187 TAFQYIIDNKGIDSDASY-------PYKAMDQKCQYDSKYRAATC--------------SKYT-- 228

  Fly   225 YAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILYKDGVYQHEHGKELGGHAIRI 288
               :..:|      |.:|  ::|.:...|||. |....:....||:.|||......:...|.:.:
Human   229 ---ELPYG------REDV--LKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLV 282

  Fly   289 LGWG-VWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIES 331
            :|:| :.|:|   |||:.|||..::|:.|:.|:.|.: :||||.|
Human   283 VGYGDLNGKE---YWLVKNSWGHNFGEEGYIRMARNKGNHCGIAS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 5/25 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 79/253 (31%)
CTSSNP_004070.3 PTZ00203 5..326 CDD:185513 88/305 (29%)
Inhibitor_I29 28..87 CDD:214853 3/14 (21%)
Peptidase_C1 115..329 CDD:278538 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.