DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSO

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:257 Identity:71/257 - (27%)
Similarity:109/257 - (42%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHT 151
            ||..||    |.:...:.::|:|..||.||||..|.|:.....|.  ||.....|...::.|.:.
Human   108 LPLRFD----WRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIK--GKPLEDLSVQQVIDCSYN 166

  Fly   152 CGFGCNGGFPGAAWSYWTRKGIV-----SGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTP 211
             .:|||||....|.: |..|..|     |..|:.:..|.       | |:.:|            
Human   167 -NYGCNGGSTLNALN-WLNKMQVKLVKDSEYPFKAQNGL-------C-HYFSG------------ 209

  Fly   212 KCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKD---GVY 273
              ||   ||:::.       |..:|.......|:.:.::|.||:    .|..|.:.::|   |:.
Human   210 --SH---SGFSIK-------GYSAYDFSDQEDEMAKALLTFGPL----VVIVDAVSWQDYLGGII 258

  Fly   274 QHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISA 335
            ||........||:.|.|:...|  ..|||::.|||.:.||..|:..:..|.:.|||..|:|:
Human   259 QHHCSSGEANHAVLITGFDKTG--STPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/256 (27%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 70/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.