DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSV

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens


Alignment Length:308 Identity:85/308 - (27%)
Similarity:136/308 - (44%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGD-LYVNSVDELPEEFDSRKQWPNCPT 102
            :|:..|....:|....|::||...: .||.   |.:|..: |::    :||:..|.||:....| 
Human    73 FTMAMNAFGDMTNEE
FRQMMGCFRN-QKFR---KGKVFREPLFL----DLPKSVDWRKKGYVTP- 128

  Fly   103 IGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWS 166
               :::|..|||||||.|..|:..::...:|..|:  .|..:||.|....| .||||||...|:.
Human   129 ---VKNQKQCGSCWAFSATGALEGQMFRKTGKLVS--LSEQNLVDCSRPQGNQGCNGGFMARAFQ 188

  Fly   167 YWTRKGIVSGGPYGSNQGCRPY----EISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAK 227
            |     :...|...|.:. .||    ||  |::.              |:.|....:|:|| .|.
Human   189 Y-----VKENGGLDSEES-YPYVAVDEI--CKYR--------------PENSVANDTGFTV-VAP 230

  Fly   228 DKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHE--HGKELGGHAIRIL 289
            .|.            :.:.:.:.|.||:..|... :.....||.|:|...  ..|.| .|.:.::
Human   231 GKE------------KALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNL-DHGVLVV 282

  Fly   290 GWGVWG--EEKIPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334
            |:|..|  .....|||:.|||..:||.:|:.:|.:.: :||||.::.|
Human   283 GYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAAS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/24 (25%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/258 (28%)
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 3/13 (23%)
Peptidase_C1 114..332 CDD:306594 74/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.