DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSL

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:378 Identity:91/378 - (24%)
Similarity:148/378 - (39%) Gaps:100/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFA 68
            |:|.|....:|:.|     |..|..:|...:|   |....|           ||.|::.:..:.|
Human     5 LILAAFCLGIASAT-----LTFDHSLEAQWTK---WKAMHN-----------RLYGMNEEGWRRA 50

  Fly    69 LPDK------------RE----------VLGDLYVNSVDELPEEFDSRK---------------- 95
            :.:|            ||          ..||:......::...|.:||                
Human    51 VWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAP 115

  Fly    96 ---QWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGC 156
               .|.....:..:::||.|||||||.|..|:..::...:|..::  .|..:||.|....| .||
Human   116 RSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLIS--LSEQNLVDCSGPQGNEGC 178

  Fly   157 NGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGY 221
            |||....|:.|     :...|...|.:. .|||         .|...|.:   .||.|....:|:
Human   179 NGGLMDYAFQY-----VQDNGGLDSEES-YPYE---------ATEESCKY---NPKYSVANDTGF 225

  Fly   222 TVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVY-QHEHGKELGGH 284
             ||..|.:             :.:.:.:.|.||:..|... :|..:.||:|:| :.:...|...|
Human   226 -VDIPKQE-------------KALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDH 276

  Fly   285 AIRILGWGVWGEE--KIPYWLIGNSWNTDWGDHGFFRILRG-QDHCGIESSIS 334
            .:.::|:|....|  ...|||:.|||..:||..|:.::.:. ::||||.|:.|
Human   277 GVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/39 (21%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/272 (26%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 12/71 (17%)
Peptidase_C1 114..332 CDD:395062 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.