DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSK

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_000387.1 Gene:CTSK / 1513 HGNCID:2536 Length:329 Species:Homo sapiens


Alignment Length:340 Identity:86/340 - (25%)
Similarity:132/340 - (38%) Gaps:114/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDL-----------------YVNSVDEL---- 87
            |.:||         :|||  .::.|:    ..|||:                 :..|.|.|    
Human    61 NLEAS---------LGVH--TYELAM----NHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPE 110

  Fly    88 -----PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVS 147
                 |:..|.||:....|    :::||.|||||||.:|.|:..::...:|..:|  .|..:||.
Human   111 WEGRAPDSVDYRKKGYVTP----VKNQGQCGSCWAFSSVGALEGQLKKKTGKLLN--LSPQNLVD 169

  Fly   148 CCHTCGFGCNGGFPGAAWSYWTR-KGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHG--GR 209
            |... ..||.||:...|:.|..: :||.|...|       ||.         |....|.:.  |:
Human   170 CVSE-NDGCGGGYMTNAFQYVQKNRGIDSEDAY-------PYV---------GQEESCMYNPTGK 217

  Fly   210 TPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQE--------EIMTNGPV----EGAFTVY 262
            ..||                          |..|||.|        .:...|||    :.:.|.:
Human   218 AAKC--------------------------RGYREIPEGNEKALKRAVARVGPVSVAIDASLTSF 256

  Fly   263 EDLILYKDGVYQHEH-GKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH 326
            :   .|..|||..|. ..:...||:..:|:|:....|  :|:|.|||..:||:.|:..:.|.:::
Human   257 Q---FYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNK--HWIIKNSWGENWGNKGYILMARNKNN 316

  Fly   327 -CGIESSISAGLPKL 340
             |||.:  .|..||:
Human   317 ACGIAN--LASFPKM 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/19 (32%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/264 (27%)
CTSKNP_000387.1 Inhibitor_I29 26..85 CDD:214853 10/38 (26%)
Peptidase_C1 115..327 CDD:306594 71/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.