DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSH

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:336 Identity:86/336 - (25%)
Similarity:137/336 - (40%) Gaps:72/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRL-------MGVHPDAHKF--ALPDKREVLGDLY 80
            ::|:...:::.|..|   |..:|.....|..::       |......||:  :.|.........|
Human    48 TEEYHHRLQTFASNW---RKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNY 109

  Fly    81 VNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDL 145
            :......|...|.||:.   ..:..:::||:|||||.|....|:...:.|.:|..::  .:...|
Human   110 LRGTGPYPPSVDWRKKG---NFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLS--LAEQQL 169

  Fly   146 VSCCHTC-GFGCNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGG 208
            |.|.... ..||.||.|..|:.| ...|||:....|       ||:                  |
Human   170 VDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTY-------PYQ------------------G 209

  Fly   209 RTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTN-----GPVEGAFTVYEDLILY 268
            :...|..  |.|..:.:.||.          .|:....||.|..     .||..||.|.:|.::|
Human   210 KDGYCKF--QPGKAIGFVKDV----------ANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMY 262

  Fly   269 KDGVYQ----HEHGKELGGHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRILRGQDHC 327
            :.|:|.    |:...:: .||:..:|:|    ||  ||||::.|||...||.:|:|.|.||::.|
Human   263 RTGIYSSTSCHKTPDKV-NHAVLAVGYG----EKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMC 322

  Fly   328 GIESSISAGLP 338
            |:.:..|..:|
Human   323 GLAACASYPIP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/45 (16%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 74/260 (28%)
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 7/44 (16%)
Peptidase_C1 117..332 CDD:278538 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.