DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSB

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001371643.1 Gene:CTSB / 1508 HGNCID:2527 Length:339 Species:Homo sapiens


Alignment Length:340 Identity:194/340 - (57%)
Similarity:239/340 - (70%) Gaps:23/340 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLVATAASVAALTSGEPSL--LSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHK 66
            ||::|.|.|       .||.  ||||.:..|..:..||..|.|| .:|...:::||.|......|
Human    11 LLVLANARS-------RPSFHPLSDELVNYVNKRNTTWQAGHNF-YNVDMSYLKRLCGTFLGGPK 67

  Fly    67 FALPDKREVL-GDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCI 130
               |.:|.:. .||      :||..||:|:|||.||||.|||||||||||||||||||:|||:||
Human    68 ---PPQRVMFTEDL------KLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICI 123

  Fly   131 HSGGKVNFHFSADDLVSCCHT-CGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCE 194
            |:...|:...||:||::||.: ||.|||||:|..||::|||||:||||.|.|:.|||||.|.|||
Human   124 HTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCE 188

  Fly   195 HHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAF 259
            |||||:||||...|.|||||.:|:.||:..|.:|||:|..||||..:.::|..||..||||||||
Human   189 HHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAF 253

  Fly   260 TVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQ 324
            :||.|.:|||.|||||..|:.:||||||||||||  |...||||:.|||||||||:|||:|||||
Human   254 SVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV--ENGTPYWLVANSWNTDWGDNGFFKILRGQ 316

  Fly   325 DHCGIESSISAGLPK 339
            |||||||.:.||:|:
Human   317 DHCGIESEVVAGIPR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 14/39 (36%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 164/248 (66%)
CTSBNP_001371643.1 Propeptide_C1 26..65 CDD:400445 14/39 (36%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 164/248 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 380 1.000 Domainoid score I850
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37550
Inparanoid 1 1.050 403 1.000 Inparanoid score I1921
Isobase 1 0.950 - 0 Normalized mean entropy S2776
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D439739at33208
OrthoFinder 1 1.000 - - FOG0001215
OrthoInspector 1 1.000 - - oto90723
orthoMCL 1 0.900 - - OOG6_101151
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2465
SonicParanoid 1 1.000 - - X1059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.