DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctss

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001254624.2 Gene:Ctss / 13040 MGIID:107341 Length:341 Species:Mus musculus


Alignment Length:303 Identity:87/303 - (28%)
Similarity:133/303 - (43%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCPT 102
            |:.||.|....:|...|...||    |.:......:.|....|.|..  ||:..|.|::  .|.|
Mouse    81 TYQVGMNDMGDMTNEE
ILCRMG----ALRIPRQSPKTVTFRSYSNRT--LPDTVDWREK--GCVT 137

  Fly   103 IGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGF---GCNGGFPGAA 164
              |::.|||||:||||.||.|:..::.:.:|..::  .||.:||.|.:...:   ||.||:...|
Mouse   138 --EVKYQGSCGACWAFSAVGALEGQLKLKTGKLIS--LSAQNLVDCSNEEKYGNKGCGGGYMTEA 198

  Fly   165 WSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDK 229
            :.|     |:..|...:: ...||:.:..:.|.|..       .|...||...|          .
Mouse   199 FQY-----IIDNGGIEAD-ASYPYKATDEKCHYNSK-------NRAATCSRYIQ----------L 240

  Fly   230 HFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGV 293
            .||.:.        .::|.:.|.|||. |....:.....||.|||..........|.:.::|:|.
Mouse   241 PFGDED--------ALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGT 297

  Fly   294 W-GEEKIPYWLIGNSWNTDWGDHGFFRILR-GQDHCGIESSIS 334
            . |::   |||:.|||..::||.|:.|:.| .::||||.|..|
Mouse   298 LDGKD---YWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/25 (32%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 74/253 (29%)
CtssNP_001254624.2 Inhibitor_I29 37..96 CDD:214853 5/14 (36%)
Peptidase_C1 124..339 CDD:278538 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.