DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsc

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:326 Identity:93/326 - (28%)
Similarity:146/326 - (44%) Gaps:56/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIEVVRSKAKTWTVG--RNFDASVTEGHIRRLMGVHPDAHKFALP-DKREVLGDLYVNSVDELPE 89
            |::.:.:..|:||..  :.::.......|||      ..|...:| .|...:.|.....:..|||
Mouse   174 FVKAINTVQKSWTATAYKEYEKMSLRDLIRR
------SGHSQRIPRPKPAPMTDEIQQQILNLPE 232

  Fly    90 EFDSRKQWPNCP---TIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHT 151
            .:|    |.|..   .:..:|:|.|||||::|.::..:..|:.|.:........|..::|| |..
Mouse   233 SWD----WRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVS-CSP 292

  Fly   152 CGFGCNGGFPG-AAWSYWTRKGIVSGGPYGSNQGCRPY--EISPCEHHVNGTRPPCAHGGRTPKC 213
            ...||:||||. .|..|....|:|       .:.|.||  :.|||:...|               
Mouse   293 YAQGCDGGFPYLIAGKYAQDFGVV-------EESCFPYTAKDSPCKPREN--------------- 335

  Fly   214 SHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHE-- 276
               |...|:.||    ::....|. ..|...::.|::.:||:..||.|::|.:.|..|:|.|.  
Mouse   336 ---CLRYYSSDY----YYVGGFYG-GCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGL 392

  Fly   277 ----HGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISAGL 337
                :..||..||:.::|:|......|.||:|.|||.::||:.|:|||.||.|.|.|||...|.:
Mouse   393 SDPFNPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAI 457

  Fly   338 P 338
            |
Mouse   458 P 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/37 (19%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 79/259 (31%)
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926
Pox_I6 168..>204 CDD:252691 5/29 (17%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.