DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AgaP_AGAP001960

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_321102.4 Gene:AgaP_AGAP001960 / 1281163 VectorBaseID:AGAP001960 Length:302 Species:Anopheles gambiae


Alignment Length:187 Identity:50/187 - (26%)
Similarity:74/187 - (39%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ATAASVAAL--TSGEPSLLSD-----------------------EFIEVVRSKAKTWTVGRN--- 44
            ||||:.|.:  |:.|..|...                       |.::.::...|.:..|.|   
Mosquito    97 ATAAAAAPVITTTTESDLFRSYMQTHRKKYYAKYRADRRRSALMENMQEIQEHNKAYEAGSNRFR 161

  Fly    45 -----FDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSR-KQWPNCPTI 103
                 |.......:.:||:.:..|.|:...|    .:.|..|:|.:|||.|.|.| |.:...|. 
Mosquito   162 MAPNAFADMHNSEYRKRLVRLKTDPHRKVEP----AVADEIVSSSNELPAELDWREKGFKTAPA- 221

  Fly   104 GEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGG 159
                :|.|||||:||....|:|.::..|. |:|.. .|...:|.|....| .||.||
Mosquito   222 ----NQKSCGSCYAFSVAYAISAQLMKHI-GRVEL-VSEQQMVDCSTANGNLGCGGG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/70 (10%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 27/74 (36%)
AgaP_AGAP001960XP_321102.4 Inhibitor_I29 115..175 CDD:285458 5/59 (8%)
Pept_C1 205..>301 CDD:214761 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.