DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CtsB1 and AgaP_AGAP003875

DIOPT Version :9

Sequence 1:	NP_001259536.2	Gene:	CtsB1 / 32341	FlyBaseID:	FBgn0030521	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	XP_310440.5	Gene:	AgaP_AGAP003875 / 1271609	VectorBaseID:	AGAP003875	Length:	140	Species:	Anopheles gambiae

Alignment Length:	67	Identity:	22/67 - (32%)
Similarity:	37/67 - (55%)	Gaps:	9/67 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   267 LYKDGVYQHEHGKELG--GHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGI 329
            ||.:|:|..|...:..  .||:.:||:      ...||::.|.|.: ||:.|:.|:.||::.|||
Mosquito    74 LYSNGIYDDEASCDNSKVNHAMLLLGY------TKDYWILKNWWGS-WGEDGYMRLARGKNLCGI 131

  Fly   330 ES 331
            .:
Mosquito   132 SN 133

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CtsB1	NP_001259536.2	Propeptide_C1	24..64	CDD:285358
CtsB1	NP_001259536.2	Peptidase_C1A_CathepsinB	88..336	CDD:239111	22/67 (33%)
AgaP_AGAP003875	XP_310440.5	Peptidase_C1A	<23..138	CDD:239068	22/67 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900