DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AgaP_AGAP007684

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_001687862.1 Gene:AgaP_AGAP007684 / 1269545 VectorBaseID:AGAP007684 Length:463 Species:Anopheles gambiae


Alignment Length:346 Identity:101/346 - (29%)
Similarity:148/346 - (42%) Gaps:60/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALTSGEPSLLSDEFI-----EVVRS---KAKTWTV--GRNFDASVTEGHIRRLMGVHPDAHKFAL 69
            ::|..|...|:|:.:     .:.||   ||..::.  |..:|    ||.:.||....|   :|.:
Mosquito   117 SVTCTEDVCLADDDLLRQLHHLERSIGWKATNYSEWWGHKYD----EGKVLRLGTFQP---RFRV 174

  Fly    70 PDKREVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGG 134
            ...:.:     .|....||..||:.:.|..  .:.|.||||.|||.|||......|||..|.|.|
Mosquito   175 KAMKRL-----SNKGGHLPTRFDASEHWTG--LVAEARDQGWCGSSWAFSTATMASDRFAILSKG 232

  Fly   135 KVNFHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISP--CEHHV 197
            :.....:...:::|... ..||:||....||.|..|.|:|       |:.|.||..:.  |:...
Mosquito   233 REMVQLAPQQMLACVRR-QQGCSGGHLDTAWQYLRRTGVV-------NEECYPYIAAQNVCKISN 289

  Fly   198 NGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVY 262
            :.|.       .|..|....:...|:.|.....|.      ..|..:|..||...|.|:....||
Mosquito   290 DDTL-------ITANCELPVKVNRTLMYKMGPAFS------LNNETDIMAEIKDRGTVQAIMRVY 341

  Fly   263 EDLILYKDGVYQHEHG-----KELGGHAIRILGWGVWGEEK-----IPYWLIGNSWNTDWGDHGF 317
            .|...|:.|:|:|...     :....|::|::|   ||||:     :.||:..|||...||::|.
Mosquito   342 RDFFSYRSGIYRHSAAATPAEERSAYHSVRLIG---WGEERVGYDVVKYWIAINSWGQWWGENGR 403

  Fly   318 FRILRGQDHCGIESSISAGLP 338
            ||||||.:.|.|||.:.|..|
Mosquito   404 FRILRGSNECDIESYVLASNP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 13/49 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 81/259 (31%)
AgaP_AGAP007684XP_001687862.1 Somatomedin_B 37..78 CDD:279385
VWC 89..>136 CDD:302663 4/18 (22%)
Peptidase_C1A_CathepsinB 188..421 CDD:239111 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.