DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSC

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:326 Identity:97/326 - (29%)
Similarity:149/326 - (45%) Gaps:49/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIEVVRSKAKTWTVGRNFD-ASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEF 91
            |::.:.:..|:||.....: .::|.|.:.|..|.|  :.|...|....:..::. ..:..||..:
Human   174 FVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGH--SRKIPRPKPAPLTAEIQ-QKILHLPTSW 235

  Fly    92 DSRKQWPNCPTI---GEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG 153
            |    |.|...|   ..:|:|.|||||::|.::..:..|:.|.:........|..::|||.....
Human   236 D----WRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQ 296

  Fly   154 FGCNGGFPG-AAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVC 217
             ||.||||. .|..|....|:|       .:.|.||         .||..||       |....|
Human   297 -GCEGGFPYLIAGKYAQDFGLV-------EEACFPY---------TGTDSPC-------KMKEDC 337

  Fly   218 QSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHE------ 276
            ...|:.:|    |:....|. ..|...::.|::.:||:..||.||:|.:.||.|:|.|.      
Human   338 FRYYSSEY----HYVGGFYG-GCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPF 397

  Fly   277 HGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISAG--LPK 339
            :..||..||:.::|:|......:.||::.|||.|.||::|:|||.||.|.|.|||...|.  :||
Human   398 NPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPK 462

  Fly   340 L 340
            |
Human   463 L 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 9/36 (25%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 81/257 (32%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344
Peptidase_C1A_CathepsinC 231..460 CDD:239112 83/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.