DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and LOC100333521

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002661007.2 Gene:LOC100333521 / 100333521 -ID:- Length:301 Species:Danio rerio


Alignment Length:277 Identity:82/277 - (29%)
Similarity:118/277 - (42%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YVNSVDELPEEFDSRKQWPNCP---TIGEIRDQ---GSCGSCWAFGAVEAMSDRVCI-HSGGKVN 137
            |:| |.:||..:|    |.|..   .:...|:|   ..||||||.|:..|::||:.| ..|...:
Zfish    52 YLN-VSDLPASWD----WRNIDGKNYVSITRNQHIPQYCGSCWAMGSTSALADRINIKRKGAWPS 111

  Fly   138 FHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGI---VSGGPYGSNQGCRPYEISPCEHHVNG 199
            .:.|..:::. |...| .|.||.....::|....||   ........||.|.|:  :.|     |
Zfish   112 AYLSVQNVID-CGKAG-SCFGGDHLGVYAYANEHGIPDETCNNYQARNQKCDPF--NQC-----G 167

  Fly   200 TRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYED 264
            |   |:..|   .||.:  ..|||....|  :|..|...|     ::.||..|||:..|....:.
Zfish   168 T---CSFFG---SCSII--KNYTVWKVGD--YGDISGRDR-----MKAEIFKNGPISCAIMATKG 217

  Fly   265 LILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCG- 328
            |..|..||:...|...:..|.|.:.|||| .|:...||::.|||...||:.|:.||:......| 
Zfish   218 LEAYDGGVFAEFHILSMPNHIISVAGWGV-TEDGTEYWIVRNSWGEFWGESGWARIVTSAYKGGK 281

  Fly   329 -------IESSISAGLP 338
                   ||:..:.|.|
Zfish   282 GNWYNVAIENDCAYGDP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 76/265 (29%)
LOC100333521XP_002661007.2 Peptidase_C1A_CathepsinX 58..299 CDD:239149 79/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.