DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and pitpnc1b

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:XP_005157947.1 Gene:pitpnc1b / 492803 ZFINID:ZDB-GENE-041114-158 Length:305 Species:Danio rerio


Alignment Length:320 Identity:124/320 - (38%)
Similarity:178/320 - (55%) Gaps:29/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHV 65
            ||:|||||.:||||:||||.|||||:|.|.|:| |.|.|||::.|||..|...|:||.|:|..::
Zfish     1 MLVKEYRICMPLTVDEYRIGQLYMISKHSNEQS-GGGEGVEVVRNEPCTDPKHGSGQITEKRIYL 64

  Fly    66 GNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSG 130
            .:.||.|::..:| ....:.|.|||.||||.|.|||.|:.:|.:.|||::..|||...|||....
Zfish    65 NSKLPTWMRRFVP-MVFYLTETAWNFYPYTITEYTCSFLPRFHVKIETHFKNDNGCSKNVFGDDP 128

  Fly   131 SDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNM 195
            :.:.|  |..:||:.|.:...:|.|.||...:||:|||||||.:.|        :...:|     
Zfish   129 TPMDN--VCFLDILSDPIPEKNYKKSEDLSDWVSEKTGRGPLVDGW--------RNDTKP----- 178

  Fly   196 SLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQ 260
             :|.:||.....|..:|.|.:.|.|:|. .:|.::|..||||.||.|||.|:|:|.:||.||:.|
Zfish   179 -IMCSYKRVTCSFEVYGFQGRTEDFVHR-NIRDILLVGHRQAVAWIDEWHGMTLEQVREFERKQQ 241

  Fly   261 LALAKKMGG--GEECSDDSVSEPYVSTAATAASTTGSERKKSAPAVPPIVTQQPPSAEAS 318
            .....|:..  ....||.::...:..:.:.   |..|..||..     :.|...||:::|
Zfish   242 EETNCKLKSDIASPGSDPAIRPSFTRSISV---TDESSLKKMG-----VTTLDIPSSQSS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 114/266 (43%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
pitpnc1bXP_005157947.1 SRPBCC 2..249 CDD:301327 113/265 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.