DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and vib

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster


Alignment Length:280 Identity:123/280 - (43%)
Similarity:174/280 - (62%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGP--GG---NGQYTK 60
            |.|||:|:.||||||||::|||:.:|:.|:|.: |.|.|:|::.|||::|.|  ||   :||||.
  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENT-GGGEGIEVLKNEPFEDFPLLGGKYNSGQYTY 64

  Fly    61 KIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCP-FVEK-FSLDIETYYYP-DNGYQ 122
            ||||:.:.:|.:|:.|.||.:|.:.|||||||||.||..|.| :::| |.:||.:.:.. |.|..
  Fly    65 KIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTV 129

  Fly   123 DNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPL-AEDWLEEYWREVKG 186
            |||.:|:...|:.|.:..|||..|.:...||..:|||..:.|.||||||| ..||          
  Fly   130 DNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDW---------- 184

  Fly   187 KKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIED 251
            ||...|    :||.||:...||:::|:||::|.||.. :.|::....|||.:...|.|:|||:||
  Fly   185 KKHVNP----VMTCYKLVTCEFKWFGLQTRVENFIQK-SERRLFTNFHRQVFCSTDRWYGLTMED 244

  Fly   252 IRELERQTQLALAKKMGGGE 271
            ||.:|.||:..|.|....||
  Fly   245 IRAIEDQTKEELDKARQVGE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 121/275 (44%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 120/274 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105030at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10658
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.