DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and pitpnb

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:NP_989122.1 Gene:pitpnb / 394727 XenbaseID:XB-GENE-5775924 Length:271 Species:Xenopus tropicalis


Alignment Length:268 Identity:114/268 - (42%)
Similarity:167/268 - (62%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYK-DGPGGNGQYTKKIYH 64
            :||||||:.||::||||::.||:.:|:.|::.: |.|.|:|::.||||: ||.  .||||.||||
 Frog     2 VLIKEYRVLLPVSVEEYQVGQLFSVAEASKDNT-GGGEGIEVLKNEPYELDGE--KGQYTHKIYH 63

  Fly    65 VGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFV-EKFSLDIETYYYPDNGYQDNVFQL 128
            :.:.:||::|.:.|:.:|...|:|||||||.||..|..:: :.|.:.|||::.||.|.|:||..|
 Frog    64 LQSKVPGFVKMVAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDNFFVKIETWHKPDFGDQENVHGL 128

  Fly   129 SGSDLRNRIVDVIDIV-KDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTP 192
            ..:..:...|..|||. ..|:..|||...|||..:.|:|||||||.:||           |:...
 Frog   129 DSNTWKEVEVVPIDIADNSQINEGDYKANEDPACYRSEKTGRGPLKQDW-----------KKELA 182

  Fly   193 RNMSL--MTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIREL 255
            .|.|.  |.|||:..|:|::||:|.|:|:|||... :::....|||.:...|.|..||:||||.:
 Frog   183 NNPSCPHMCAYKLVTVKFQWWGLQGKVERFIHKQE-KRLFTNFHRQLFCSLDRWVELTMEDIRRM 246

  Fly   256 ERQTQLAL 263
            |.:||..|
 Frog   247 EDETQKEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 114/268 (43%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
pitpnbNP_989122.1 SRPBCC_PITPNA-B_like 3..259 CDD:176897 114/267 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.