DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and rdgBbeta

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster


Alignment Length:288 Identity:126/288 - (43%)
Similarity:177/288 - (61%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHV 65
            :||||||:.:|||||||:|.||||||:.|.|:|. ||.|||::.|:|.:|...|.||||:|..|:
  Fly     2 VLIKEYRVCMPLTVEEYKIGQLYMIARHSLEQSE-EGEGVEVVENKPCEDPVHGKGQYTEKHIHL 65

  Fly    66 GNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSG 130
            .:.||.||:::.|: ...|.|::||.||||.|.|||.|:.|.::.|:|.|..:||..:|...|:.
  Fly    66 SSRLPYWIQAICPR-VFYVIEKSWNYYPYTLTEYTCSFIPKLNVLIKTKYEDNNGSTENCLDLTE 129

  Fly   131 SDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNM 195
            .:|:.|.||.:||..|::....|.||||||.|.|:||.||||.|.|.|              .:.
  Fly   130 DELKVRTVDHLDIAFDEVSAKHYKKEEDPKFFKSEKTNRGPLIEGWRE--------------TDK 180

  Fly   196 SLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQ 260
            .:|.:||:....|..||:|||:|.||.. .:|:::|..||||:||.|||.|:|:||:|..|||.|
  Fly   181 PIMCSYKVVHASFEVWGLQTKVEDFIQR-GIREILLLGHRQAFAWVDEWHGMTLEDVRAYERQKQ 244

  Fly   261 LALAKKM----GG------GEECSDDSV 278
            ....:|:    ||      .:|.:|..:
  Fly   245 AETNEKIHNTSGGANAAANAKEANDGDI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 122/270 (45%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:301327 122/265 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105030at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10658
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.