DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and PITPNC1

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:NP_036549.2 Gene:PITPNC1 / 26207 HGNCID:21045 Length:332 Species:Homo sapiens


Alignment Length:345 Identity:144/345 - (41%)
Similarity:200/345 - (57%) Gaps:38/345 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHV 65
            ||:|||||.:||||:||:|.|||||:|.|.|:| ..|.|||::.|||::|...||||:|:|..::
Human     1 MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQS-DRGEGVEVVQNEPFEDPHHGNGQFTEKRVYL 64

  Fly    66 GNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSG 130
            .:.||.|.::::|| ...|.|:|||.||||.|.|||.|:.|||:.|||.|..:.|..|.:|....
Human    65 NSKLPSWARAVVPK-IFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEA 128

  Fly   131 SDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNM 195
            .|: .|.|..|||..|::....|.:.||||||.|:|||||.|.|.|.:.:        ||     
Human   129 KDV-EREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSH--------QP----- 179

  Fly   196 SLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQ 260
             :|.:||:..|:|..||:||::|:|:|.| :|.::|..||||:||.|||:.:|::::||.||.||
Human   180 -IMCSYKLVTVKFEVWGLQTRVEQFVHKV-VRDILLIGHRQAFAWVDEWYDMTMDEVREFERATQ 242

  Fly   261 LALAKKMG--------GGEECSDDSVSEPYVSTAATAASTTGSE---------RKKSAPAVPPIV 308
            .|..||:|        ........||.....|..:|..||...|         ||||||..   :
Human   243 EATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPET---L 304

  Fly   309 TQQPPSAEASSDEEGEEEED 328
            |...|..:|:.:..|....|
Human   305 TLPDPEKKATLNLPGMHSSD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 125/266 (47%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
PITPNC1NP_036549.2 SRPBCC_PITPNC1_like 2..250 CDD:176899 124/265 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..332 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.