DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and Pitpna

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:NP_032876.1 Gene:Pitpna / 18738 MGIID:99887 Length:271 Species:Mus musculus


Alignment Length:265 Identity:114/265 - (43%)
Similarity:168/265 - (63%) Gaps:13/265 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHV 65
            :|:||||:.||::|:||::.|||.:|:.|:.|: |.|.|||:::||||:...|..||||.||||:
Mouse     2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNET-GGGEGVEVLVNEPYEKDDGEKGQYTHKIYHL 65

  Fly    66 GNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFV-EKFSLDIETYYYPDNGYQDNVFQLS 129
            .:.:|.:::.|.|:.||.:.|:|||||||.||..|..:: |.|.:.|||::.||.|.|:||.:|.
Mouse    66 QSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLE 130

  Fly   130 GSDLRNRIVDVIDIV-KDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPR 193
            ....::.....|||. :.|:...||..||||..|.|.|||||||..:|.:|.   |..|..|   
Mouse   131 PEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLGPNWKQEL---VNQKDCP--- 189

  Fly   194 NMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQ 258
               .|.|||:..|:|::||:|.|:|.|||... :::....|||.:.|.|:|..||::|||.:|.:
Mouse   190 ---YMCAYKLVTVKFKWWGLQNKVENFIHKQE-KRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEE 250

  Fly   259 TQLAL 263
            |:..|
Mouse   251 TKRQL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 114/265 (43%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
PitpnaNP_032876.1 SRPBCC_PITPNA-B_like 3..260 CDD:176897 114/264 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.