DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgB and Pitpnb

DIOPT Version :9

Sequence 1:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster
Sequence 2:XP_006249584.1 Gene:Pitpnb / 114561 RGDID:620143 Length:272 Species:Rattus norvegicus


Alignment Length:283 Identity:109/283 - (38%)
Similarity:167/283 - (59%) Gaps:20/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHV 65
            :||||:|:.||.:|:||::.|||.:|:.|:.|: |.|.|:|::.|||| :..|..||||.||||:
  Rat     2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNET-GGGEGIEVLKNEPY-ENDGEKGQYTHKIYHL 64

  Fly    66 GNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFV-EKFSLDIETYYYPDNGYQDNVFQLS 129
            .:.:|.:::.:.|:.:|...|:|||||||.||..|..:: :.|.:.|||::.||.|..:||..|.
  Rat    65 KSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLD 129

  Fly   130 GSDLRNRIVDVIDIV-KDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPR 193
            .:..:...:..|||. :.|:...||..:|||..|.|.||.||||..:|.:|.        ..|| 
  Rat   130 PNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKEL--------ANTP- 185

  Fly   194 NMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQ 258
            :...|.|||:..::|::||:|:|:|.||.... :::....|||.:.|.|:|..||:||||.:|.:
  Rat   186 DCPKMCAYKLVTIKFKWWGLQSKVENFIQKQE-KRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDE 249

  Fly   259 TQLAL------AKKMGGGEECSD 275
            ||..|      .:..|....|.|
  Rat   250 TQKELETLRSQGQVRGTSAACDD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 106/274 (39%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
PitpnbXP_006249584.1 SRPBCC_PITPNA-B_like 3..258 CDD:176897 106/266 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.