DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD8 and Ubx

DIOPT Version :9

Sequence 1:NP_062458.1 Gene:HOXD8 / 3234 HGNCID:5139 Length:290 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:270 Identity:91/270 - (33%)
Similarity:111/270 - (41%) Gaps:64/270 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    41 GGRHAAAAAALQLYGNSAAGFPHAP-------------------PQAHAHPHPSPPPSGTGCGGR 86
            |..:...||......|.|.|.|..|                   |.:|.........|.:|..|.
  Fly   131 GNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGN 195

Human    87 EGRGQEYFHPGGGSPA---------AAYQAAPPPPPHPPPPPPPPPCGGIA--CHGEPAKFYGYD 140
            .|..|......|...|         ||.|.|.....|........|...||  |..:|.|     
  Fly   196 AGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTK----- 255

Human   141 NLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFP-WMRPQAAPGRRRGRQTY 204
                     ::..::|.||       |.|..|.......|....:.| |:.....  ||||||||
  Fly   256 ---------SKIRSDLTQY-------GGISTDMGKRYSESLAGSLLPDWLGTNGL--RRRGRQTY 302

Human   205 SRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVK 269
            :|:|||||||||..|.||||:||||::|||.|||||:||||||||||.|||         .|.:|
  Fly   303 TRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE---------IQAIK 358

Human   270 D-GETKKEAQ 278
            : .|.:|:||
  Fly   359 ELNEQEKQAQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD8NP_062458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..127 18/94 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 8/39 (21%)
Homeobox 201..253 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..290 7/25 (28%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.