Sequence 1: | NP_062458.1 | Gene: | HOXD8 / 3234 | HGNCID: | 5139 | Length: | 290 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 287 | Identity: | 74/287 - (25%) |
---|---|---|---|
Similarity: | 94/287 - (32%) | Gaps: | 110/287 - (38%) |
- Green bases have known domain annotations that are detailed below.
Human 56 NSAAGFPHA-PPQAHAHPHPSPP---------------------------PSGTGCGG------- 85
Human 86 -REGRGQEYFH-----------------------PGGGSPAAAYQAAPPPPPHPPP-------PP 119
Human 120 PPP---------PCGGIACHG-----EPAKFYGYDNLQRQPIFTTQQEAELVQYPDC-------- 162
Human 163 KSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRR 227
Human 228 IEVSHALALTERQVKIWFQNRRMKWKK 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXD8 | NP_062458.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 60..127 | 28/141 (20%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..200 | 10/46 (22%) | |||
Homeobox | 201..253 | CDD:278475 | 25/51 (49%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 255..290 | 74/287 (26%) | |||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 24/50 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |