DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pla1a

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:238 Identity:75/238 - (31%)
Similarity:99/238 - (41%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 QLKSSDYDYTSSEEAAD-----------------QWKS------AKAASGDLIIID--LGSTLTN 206
            ||...|.|..:||..|.                 .|.:      .:||..::|.:|  .|||...
  Rat    65 QLVEEDSDIRNSEFNASLGTKLIIHGFRALGTKPSWINKFIRALLRAADANVIAVDWVYGSTGMY 129

  Fly   207 FKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITG 271
            |.  |:.:|:.....|.:.|..|...||.:..||:||..:.|||.|..|:.|..|.|    ||||
  Rat   130 FS--AVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLG----RITG 188

  Fly   272 LDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNG--PSTGVP-----GS 329
            ||||.....|..:...|..|||.||:||||.|..:|..|..|.||::.||  ...|.|     |.
  Rat   189 LDPAGPEYTRASLEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFIHAGY 253

  Fly   330 ENVIEAVARATRYFAESVRPGSERNFP--AVPANSLKQYKEQD 370
            ..:|....||...:..::    |...|  |.|..|.|.:...|
  Rat   254 SYLICDHMRAVHLYISAL----ENTCPLMAFPCASYKAFLAGD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 75/238 (32%)
Abhydrolase <215..396 CDD:304388 58/165 (35%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 75/238 (32%)
Pancreat_lipase_like 49..332 CDD:238363 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.