DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pla1a

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:235 Identity:71/235 - (30%)
Similarity:105/235 - (44%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EQQQQLKSSDYDYTSSEEA--------------ADQWKSA--KAASGDLIIID--LGSTLTNFKR 209
            |:...::||:::.:...:.              .|::.||  :||..::|.:|  .|||...:. 
Mouse    68 EEGSDIRSSEFNASLGTKVIIHGFRALGTKPSWIDKFISAVLRAADANVIAVDWVYGSTGVYYS- 131

  Fly   210 YAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDP 274
             |:.:|:.....|.:.|..|...||.:..||:||..:.|||.|..|:.|..|.|    :||||||
Mouse   132 -AVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLG----QITGLDP 191

  Fly   275 AKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNG--PSTGVP-----GSENV 332
            |.....|..:...|..|||.||:||||.|..:|..|..|.||::.||  ...|.|     |...:
Mouse   192 AGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFFHAGYNYL 256

  Fly   333 IEAVARATRYFAESVRPGSERNFP--AVPANSLKQYKEQD 370
            |....||...:..::    |...|  |.|..|.|.:...|
Mouse   257 ICDHMRAVHLYISAL----ENTCPLMAFPCASYKAFLAGD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 71/235 (30%)
Abhydrolase <215..396 CDD:304388 57/165 (35%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.