DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:183 Identity:58/183 - (31%)
Similarity:82/183 - (44%) Gaps:40/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GAMIGQTLIDLTNKGV---PQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKV-LS 279
            ||.:.| :||:..|..   |.: :||||..:.|||||.||::...     |.|||||||.:. ..
  Rat   144 GAQVAQ-MIDILVKNYSYSPSK-VHLIGHSLGAHVAGEAGSRTPG-----LGRITGLDPVEANFE 201

  Fly   280 KRPQILGGLSRGDADFVDAIHTST------FAMGTPIRCGDVDFYPNGPSTGVPG-SENVIEAVA 337
            ..|:.: .|...||||||.|||..      ...||....|.:||:||| ...:|| .:|.:..:.
  Rat   202 GTPEEV-RLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNG-GQSMPGCKKNALSQIV 264

  Fly   338 ------------------RATRYFAESVRPGSERNFPAVPANSLKQYKEQDGF 372
                              |:.:|:.||:.  :...|.|.|..|.|.::....|
  Rat   265 DIDGIWSGTRDFVACNHLRSYKYYLESIL--NPDGFAAYPCASYKDFESNKCF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 58/183 (32%)
Abhydrolase <215..396 CDD:304388 58/183 (32%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 58/183 (32%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.