DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:273 Identity:76/273 - (27%)
Similarity:118/273 - (43%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSS---------EEAA 182
            |..|| .||||... |.|:.......|.|.:..:|    ..:::|::.....         ::..
Mouse    41 LKALP-WSPAQINT-RFLLYTNENPDNYQLITSDA----SNIRNSNFRTNRKTRIIIHGFIDKGE 99

  Fly   183 DQWKS------AKAASGDLIIID-LGSTLTNFKRYAMLDVLNTGAMIGQTLIDL--TNKGVPQEI 238
            :.|.|      .:..|.:.|.:| .|.:.|.:.: |..:|...||.:. .|:::  ::.|.....
Mouse   100 ENWLSDMCKNMFRVESVNCICVDWKGGSRTTYTQ-ATQNVRVVGAEVA-LLVNVLQSDLGYSLNN 162

  Fly   239 IHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILG-----GLSRGDADFVDA 298
            :||||..:.:|:||.||.:.....|    ||||||||:     |...|     .|...||.||||
Mouse   163 VHLIGHSLGSHIAGEAGKRTFGAIG----RITGLDPAE-----PYFQGTPEEVRLDPTDAQFVDA 218

  Fly   299 IHTST--------FAMGTPIRCGDVDFYPNGPSTGVPG-SENVIEAVARATRYFAESVRPGSERN 354
            |||..        |.|...:  |.:||:||| ...:|| .:|::..:..     .:.:..|: ||
Mouse   219 IHTDAGPIIPNLGFGMSQTV--GHLDFFPNG-GIEMPGCQKNILSQIVD-----IDGIWEGT-RN 274

  Fly   355 FPAVPANSLKQYK 367
            |.|  .|.|:.||
Mouse   275 FAA--CNHLRSYK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 76/273 (28%)
Abhydrolase <215..396 CDD:304388 55/169 (33%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 76/273 (28%)
Pancreat_lipase_like 51..348 CDD:238363 69/262 (26%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.