DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG34447

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:236 Identity:79/236 - (33%)
Similarity:110/236 - (46%) Gaps:57/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LIIIDLGSTLTNFKRY-AMLDVLNTGAMIGQTLIDLTNKGVPQEI-----IHLIGQGISAHVAGA 253
            :|.||.|..:    || ..:..:....::.:.|..|.|..|.:.|     |||||..:...|||.
  Fly   105 VISIDYGPLV----RYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQ 165

  Fly   254 AGNKYTAQTGHKLRRITGLDPAKVLSKRPQILG----GLSRGDADFVDAIHTSTFAMGTPIRCGD 314
            ..| |..:   |::|||||||||.|.    |||    .|.:|||||||.|||..|..|.....|.
  Fly   166 TAN-YVKR---KMKRITGLDPAKPLF----ILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGH 222

  Fly   315 VDFYPN-GPSTGVPG--SENVIEAVA----RATRYFAESVRPGSERNFPAVPANSLKQY--KEQD 370
            |||||| |...  ||  .||:.:..:    ||.|::|||:             |:...:  ::..
  Fly   223 VDFYPNFGAKQ--PGCMEENMQDPSSCNHERAPRFYAESI-------------NTTVGFWARQCS 272

  Fly   371 GF-----------GKRAYMGLQIDYDLRGDYILEVNAKSPF 400
            |:           |.:|.:|..:..:|||.|.|:..:|||:
  Fly   273 GWLLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASKSPY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 78/234 (33%)
Abhydrolase <215..396 CDD:304388 70/209 (33%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.