DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG34448

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:234 Identity:73/234 - (31%)
Similarity:97/234 - (41%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DLIIIDLGSTLTNFKRYAMLDVLN---TGAMIGQTLIDLTNKGVP-QEIIHLIGQGISAHVAGAA 254
            ::|.:|.| ||..:..|....|.|   ....:.|.:.:|.:.|:. :|.|||||..:.|.|||..
  Fly   106 NVISVDYG-TLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMV 169

  Fly   255 GNKYTAQTGHKLRRITGLDPA-KVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFY 318
            .| |.:|   .|.|||||||| .....:|.:...|...||||||.|||..|........|..|||
  Fly   170 AN-YVSQ---PLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFY 230

  Fly   319 PNGPSTGVPGSENVIE------AVARATRYFAESVRPGSERNFPAVPANSLKQYKEQ-----DGF 372
            ||.......|...:..      ...||..|:.||:.  |||.|          :.:|     |.|
  Fly   231 PNLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESII--SERGF----------WAQQCGGWFDFF 283

  Fly   373 GKR---------AYMGLQIDYDLRGDYILEVNAKSPFGQ 402
            .:|         ..||..:..|..|.|.|..:..:||.:
  Fly   284 SQRCSHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 71/230 (31%)
Abhydrolase <215..396 CDD:304388 65/205 (32%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 71/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.