DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:215 Identity:67/215 - (31%)
Similarity:89/215 - (41%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 WKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTL-IDLTNKGVPQEIIHLIGQGISA 248
            ||....|           |.|.    |..:|...||.:.|.| |.||....|...:||||..:.|
Human   125 WKKGSQA-----------TYTQ----AANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGA 174

  Fly   249 HVAGAAGNKYTAQTGHKLRRITGLDPAKV-LSKRPQILGGLSRGDADFVDAIHTST------FAM 306
            ||||.||:|...     |.|||||||.:. ....|:.: .|...||||||.|||..      ...
Human   175 HVAGEAGSKTPG-----LSRITGLDPVEASFESTPEEV-RLDPSDADFVDVIHTDAAPLIPFLGF 233

  Fly   307 GTPIRCGDVDFYPNGPSTGVPG-SENVIEAVA------------------RATRYFAESVRPGSE 352
            ||..:.|.:||:||| ...:|| .:|.:..:.                  |:.:|:.||:.  :.
Human   234 GTNQQMGHLDFFPNG-GESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESIL--NP 295

  Fly   353 RNFPAVPANSLKQYKEQDGF 372
            ..|.|.|..|.|.::....|
Human   296 DGFAAYPCTSYKSFESDKCF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 67/215 (31%)
Abhydrolase <215..396 CDD:304388 61/185 (33%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 67/215 (31%)
Pancreat_lipase_like 52..349 CDD:238363 67/215 (31%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.