DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and PNLIP

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:391 Identity:94/391 - (24%)
Similarity:141/391 - (36%) Gaps:133/391 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVAAHASKDASNDRLKPTKWLTATELENVPSLNDITWERLENQPLEQGAKVIEKIYHVGQIKHD 77
            ||:.|.|.|:...:||....             :|..|..:..:||           |:      
Human     9 LLLGAVAGKEVCYERLGCFS-------------DDSPWSGITERPL-----------HI------ 43

  Fly    78 LTPSFVP-SPSNVPV-WIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKA 140
                 :| ||.:|.. :::.:|...     ||:.|.|       .|..:|..:.. ||:    :.
Human    44 -----LPWSPKDVNTRFLLYTNENP-----NNFQEVA-------ADSSSISGSNF-KTN----RK 86

  Fly   141 MRRLIQAYVQKYN---LQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIID-LG 201
            .|.:|..::.|..   |..:.||.                          .|..|.:.|.:| .|
Human    87 TRFIIHGFIDKGEENWLANVCKNL--------------------------FKVESVNCICVDWKG 125

  Fly   202 STLTNFKRYAMLDVLNTGAMIGQTLIDLTNK-GVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHK 265
            .:.|.:.: |..::...||.:...:..|.:. |.....:|:||..:.||.||.||.:    |...
Human   126 GSRTGYTQ-ASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRR----TNGT 185

  Fly   266 LRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPI----------RCGDVDFYPN 320
            :.||||||||:...:....|..|...||.|||.|||.    |.||          ..|.:||:||
Human   186 IGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTD----GAPIVPNLGFGMSQVVGHLDFFPN 246

  Fly   321 GPSTGVPG-SENV------IEAVARATRYFAESVRPGSERNFPAVPANSLKQYK-------EQDG 371
            | ...:|| .:|:      |:.:...||.||              ..|.|:.||       ..||
Human   247 G-GVEMPGCKKNILSQIVDIDGIWEGTRDFA--------------ACNHLRSYKYYTDSIVNPDG 296

  Fly   372 F 372
            |
Human   297 F 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 78/309 (25%)
Abhydrolase <215..396 CDD:304388 56/183 (31%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 90/383 (23%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.