DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and PLA1A

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:189 Identity:62/189 - (32%)
Similarity:87/189 - (46%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 KAASGDLIIID--LGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVA 251
            :|.:.::|.:|  .|||...|.  |:.:|:.....|...|..|...||.:..||:||..:.|||.
Human   110 RATNANVIAVDWIYGSTGVYFS--AVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVG 172

  Fly   252 GAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVD 316
            |..|..:..|.|    :|||||||.....|..:...|..|||.||:||||.|..:|..|..|.||
Human   173 GMVGQLFGGQLG----QITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVD 233

  Fly   317 FYPNG-------PSTGVPGSENVIEAVARATRYFAESVRPGSERNFP--AVPANSLKQY 366
            ::.||       |:....|...:|....||...:..::    |.:.|  |.|..|.|.:
Human   234 YFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISAL----ENSCPLMAFPCASYKAF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 62/189 (33%)
Abhydrolase <215..396 CDD:304388 54/161 (34%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 62/189 (33%)
Pancreat_lipase_like 49..332 CDD:238363 62/189 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.