DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and liph

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis


Alignment Length:256 Identity:66/256 - (25%)
Similarity:100/256 - (39%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DLIIID--LGSTLTNFKRYA-----MLDVLNTGAMIGQTLID-LTNKGVPQEIIHLIGQGISAHV 250
            ::|::|  .|:|...:...|     :.|:|       :..|| :.::|...:.|:::|..:.||:
 Frog   111 NVIVVDWNRGATTVLYHNAAANTRKVADIL-------KRFIDNMLSQGATLDSIYMVGVSLGAHI 168

  Fly   251 AGAAGNKYTAQTGHKLRRITGLDPAKVL--SKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCG 313
            :|..|..|....|    ||||||||..|  .|.|:  ..|...||.|||.:|:.|..:|.....|
 Frog   169 SGFVGKMYNGSIG----RITGLDPAGPLFNGKPPE--ERLHYTDAQFVDVVHSDTDGLGYKESLG 227

  Fly   314 DVDFYPNG-------PSTGVPGSE--------NVIEAVARATRYFAESVRPGSERNFPAVPANSL 363
            .:||||||       |.|.:.|||        :|...:|..|:          ..:..|.|..|.
 Frog   228 HIDFYPNGGTDQPGCPKTILAGSEYFKCDHQRSVFLYIASLTK----------SCDLVAFPCKSY 282

  Fly   364 KQY------------------------KEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPF 400
            :.|                        |.:|...||.:.|....:|        ..||.|:
 Frog   283 RDYRIGNCTDCKEFLPLSCPVLGFYADKWKDHLVKRNHPGTTAFFD--------TAAKDPY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 65/254 (26%)
Abhydrolase <215..396 CDD:304388 57/222 (26%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 58/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.