DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG6277

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:375 Identity:97/375 - (25%)
Similarity:149/375 - (39%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNVPVWI--------------IKSNG-QKVECKLN 106
            |:::..:|           |.....:||.......|:              ::|.| ..|..|. 
  Fly    18 PIKESERV-----------HGENGWYVPQEDGTSEWVDMDVAEQWMEAQELLESRGLTTVPVKF- 70

  Fly   107 NYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSS 171
             |:.|: :.|..|: ::|.....:..:|.......|.:|..:.|.|....   |...:...|...
  Fly    71 -YLYTS-SNPTKGK-KITASTKSIDASSFNSAHPTRFVIHGWTQSYTASM---NKDIRSAWLSRG 129

  Fly   172 DYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRYA--MLDVLNTGAMIGQTLIDL-TNKG 233
            ||:....:     |  |:|.|.|               ||  :|.|..||..:.:.:..| .|.|
  Fly   130 DYNVIVVD-----W--ARARSVD---------------YATSVLAVAATGKKVAKMINFLKDNHG 172

  Fly   234 VPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVL------SKRPQILGGLSRGD 292
            :....:::||..:.|||||.||.    .|..::..|.|||||..|      :||      |:..|
  Fly   173 LNLNDLYVIGHSLGAHVAGYAGK----NTDGQVHTIIGLDPALPLFSYNKPNKR------LNSDD 227

  Fly   293 ADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPGSENVIEAV---ARATRYFAESVRPGSERN 354
            |.:|::|.|:...:|.....|...|||||..| .||....:...   .|:|.|:||:|   ||.|
  Fly   228 AWYVESIQTNGGTLGFLKPIGKGAFYPNGGKT-QPGCGLDLTGACSHGRSTTYYAEAV---SEDN 288

  Fly   355 FPAVPANSLKQ--YKEQDGFGKRAYMGLQID-YDLRGDYILEVNAKSPFG 401
            |..:.....::  .||.........||...: |.:.|||.:.||:|:|||
  Fly   289 FGTMKCGDYEEAVSKECGSTYSSVRMGADTNAYMVEGDYYVPVNSKAPFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 88/336 (26%)
Abhydrolase <215..396 CDD:304388 60/193 (31%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 83/307 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.