DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG17191

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:348 Identity:88/348 - (25%)
Similarity:145/348 - (41%) Gaps:69/348 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKAMRRLIQ 146
            :||.......|:.|.:.::: ...|:.:||.       .::|:..|  ..|.:|...|.:|    
  Fly    30 YVPQIDGSFEWMDKQDAEEL-LNRNSLIETR-------SNDVSFYL--YTKHNPTVGKEIR---- 80

  Fly   147 AYVQKYNLQQLQKNAQEQQQQLKSSDYDYTS--SEEAADQWKSAKAASGDLIIIDLGSTLTNFKR 209
            |...........|| |..:..:...:..||.  :.:....|.|    .||..:|     :.|:.|
  Fly    81 ADASSIEDSHFDKN-QGTRFVIHGWNGRYTDGMNVKITRAWLS----KGDYNVI-----VVNWDR 135

  Fly   210 YAMLDVLNT-------GAMIGQTLIDL-TNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKL 266
            ...:|.:::       ||.:|:.:..| .:..:..|.:.:||..:.|||||.||.:.   .|.::
  Fly   136 AQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQV---GGKRV 197

  Fly   267 RRITGLDPAKVL------SKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTG 325
            ..|.|||||..|      .||      ||..||.:|::|.|:....|.....|...||||| ...
  Fly   198 HTIVGLDPAMPLFAYDKPDKR------LSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNG-GRN 255

  Fly   326 VPGSENVIE---AVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKR---AYMGLQID- 383
            .||..:.|.   |..|:..|:.|:|   :|.||     .::|.:..|......   .|.|:::. 
  Fly   256 QPGCGSDIGGTCAHGRSVTYYVEAV---TEDNF-----GTIKCHDYQAALANECGSTYSGVRMGA 312

  Fly   384 ----YDLRGDYILEVNAKSPFGQ 402
                |.:.||:.:.||.::|||:
  Fly   313 VTNAYMVDGDFYVPVNGQAPFGK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 82/333 (25%)
Abhydrolase <215..396 CDD:304388 57/205 (28%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 76/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.