DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG4582

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:442 Identity:110/442 - (24%)
Similarity:168/442 - (38%) Gaps:99/442 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RLENQPLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNVPVWIIKSNGQKVECKLNNYV------- 109
            |:.|    :|.|.::..|...|:  .|..|.:.||..:|: :.:.:|::.:.: .:|:       
  Fly     4 RMRN----RGGKRLQANYFDTQM--PLLSSGLMSPGQLPI-LDEQHGRQEQLE-RHYLAHGPSSV 60

  Fly   110 --ETAKAQPGF-----GEDEVTIVL-TGLP------KTSP---AQQKAMRRLIQAYV-----QKY 152
              :..:.||.:     .|......| |.:|      :|.|   .::...|||.|..|     ..:
  Fly    61 EQQLLRLQPDYKLLYSAEHHTYFHLHTLVPQDNANRQTGPLKSEKESPHRRLFQQVVGNTLTAAF 125

  Fly   153 NLQQLQKNAQEQQQQLKSSD---YDYTS--------------------SEEAADQWKSAKAASGD 194
            .|..:.|..|||.||..|..   ||..|                    ..|.|:.:.....|..|
  Fly   126 GLNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFD 190

  Fly   195 L-------IIIDLGSTLTNFKRYAMLDVLNTG---AMIGQTL---IDLTNK--GVPQEIIHLIGQ 244
            |       ..:|.|       |.|:.|.:...   ..:||.|   :|..::  |:..|.:.|:|.
  Fly   191 LRNGNYNIFTVDWG-------RGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGF 248

  Fly   245 GISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTP 309
            .:.|||||.||..  .||| :||.|..||||....:..:....|:..|||:|:.:|||..:.|..
  Fly   249 SMGAHVAGLAGKH--LQTG-RLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFD 310

  Fly   310 IRCGDVDFYPNGPSTGVPGSENVIEAVARATRYFAESVRPGSERNF-----PAVPANSLKQYKE- 368
            ...|.||||.|..|. .||......:..||...||||:.......|     ||.....|.::.. 
  Fly   311 RPVGHVDFYANWGSQ-QPGCFWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRC 374

  Fly   369 -------QDGFGKRAYMGLQIDYDLRGDYILEVNAKSPFGQRSPAHKQAAYH 413
                   |...|..|.:..:.....:|.|..:.|.:.|:.....|..:.|.|
  Fly   375 PKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQNASSKRAAH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 95/386 (25%)
Abhydrolase <215..396 CDD:304388 58/201 (29%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 74/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.