DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and sxe2

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:449 Identity:102/449 - (22%)
Similarity:154/449 - (34%) Gaps:155/449 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATCLLVAAHASKDASNDRLKPTKWLTATELENVPSLNDITWERLENQPLEQGAKVIEKIYHVG 72
            ||.||||:...|..|||.|                                              
  Fly    13 LLWTCLLLLGAAGTDASVD---------------------------------------------- 31

  Fly    73 QIKHDLTPSFVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVLTGLPKTSPAQ 137
                    .|..:|.            |.|..:::.::      |....|..::| |.|:  |:|
  Fly    32 --------YFAYAPG------------KCEVSISDVIQ------GMITTEAGVIL-GRPR--PSQ 67

  Fly   138 QKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQW----------------- 185
            .|.:|         |:|.....  .|::|.|:..|.....:.....:|                 
  Fly    68 TKLLR---------YDLYTPLN--PEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCS 121

  Fly   186 ----KSAKAASG--DLIIIDLG--STLTNFKRYAMLDVLNTGAMIGQTLIDL-TNKGVPQEIIHL 241
                |.|..:.|  ::||:|..  |...::.|.:. .:.:..|.:.:.|..| .|.|||.|.|::
  Fly   122 NAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSK-QLPSIAANVAKMLRFLHDNTGVPYEQIYM 185

  Fly   242 IGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKV--LSKRPQILGGLSRGDADFVDAIHTSTF 304
            ||....:|::|..|.....   |:|..|..||||.:  ||..|:  ..|...||.:|::|||...
  Fly   186 IGHSAGSHISGLTGKLLRP---HRLGAIFALDPAGLTQLSLGPE--ERLDVNDALYVESIHTDLT 245

  Fly   305 AMGTP-IRCGDVDFYPNGPSTGVPGSENVIEAVARATR------------YFAESVRPGSERNFP 356
            .:|.| .:.....|:.|. ..|.|...|     |.||.            |||||||  ..::|.
  Fly   246 LLGNPSTKLSHASFFANW-GLGQPHCPN-----ATATEFDFVCDHFAAMFYFAESVR--QPKSFA 302

  Fly   357 AVPANSLKQYKEQ------DGFGKRA--------YMGLQIDYDLRGDYILEVNAKSPFG 401
            |:..:|.|.....      .|..|.|        :||.:.....||.:.|....:||:|
  Fly   303 ALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 87/361 (24%)
Abhydrolase <215..396 CDD:304388 60/210 (29%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 84/334 (25%)
Pancreat_lipase_like 72..356 CDD:238363 76/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.