| Sequence 1: | NP_511148.2 | Gene: | Yp3 / 32339 | FlyBaseID: | FBgn0004047 | Length: | 420 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_000228.1 | Gene: | LPL / 4023 | HGNCID: | 6677 | Length: | 475 | Species: | Homo sapiens |
| Alignment Length: | 43 | Identity: | 12/43 - (27%) |
|---|---|---|---|
| Similarity: | 22/43 - (51%) | Gaps: | 4/43 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 222 TKLKSENARQRCERWISKTQLLTAKKKMKLAEKYVLVELQNEC 264 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Yp3 | NP_511148.2 | Lipase | 93..400 | CDD:395099 | 12/43 (28%) |
| LPL | NP_000228.1 | Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 | 32..53 | ||
| lipo_lipase | 33..473 | CDD:132274 | |||
| Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 | 243..266 | ||||
| Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 | 417..421 | ||||
| Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 | 430..434 | ||||
| Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 | 443..467 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||