DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and LPL

DIOPT Version :10

Sequence 1:NP_511148.2 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:43 Identity:12/43 - (27%)
Similarity:22/43 - (51%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TKLKSENARQRCERWISKTQLLTAKKKMKLAEKYVLVELQNEC 264
            |.||||:|...|::..:|.:|....|    ..:...|:.:::|
Human   667 TSLKSEDATFMCDKRCNKKRLCGRHK----CNEICCVDKEHKC 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_511148.2 Lipase 93..400 CDD:395099 12/43 (28%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53
lipo_lipase 33..473 CDD:132274
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.