DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and LIPC

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:349 Identity:83/349 - (23%)
Similarity:136/349 - (38%) Gaps:82/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IVLTGLPKTS------PAQQKAMRRLIQAYVQKYNLQQLQK-----NAQEQQQQLKSSDYD---- 174
            |::||:..:|      |..::...|..||......|.:::.     ....|..|::.:..|    
Human    22 ILITGVTTSSEDMRKAPVSEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPDTLQE 86

  Fly   175 --YTSS------------EEAADQW-----KSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGA 220
              :.||            :...:.|     .:.|:.....:.:.|...:|....:..:.|.|| .
Human    87 CGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNT-R 150

  Fly   221 MIGQTLIDL-----TNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSK 280
            ::|:.:..|     .:..:.:..:||||..:.|||:|.||:.....  ||:.||||||.|..|.:
Human   151 LVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGT--HKIGRITGLDAAGPLFE 213

  Fly   281 RPQILGGLSRGDADFVDAIHTST-----FAMGTPIRCGDVDFYPNGPSTGVPG----------SE 330
            .......||..||:|||||||.|     .::|.....|..||||||.|. .||          ::
Human   214 GSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSF-QPGCHFLELYRHIAQ 277

  Fly   331 NVIEAVA--------RATRYFAESVRPGSERN--FPAVPANSLKQYKEQDGF------GKRAYMG 379
            :...|:.        |:...|.:|:.....::  :|....||..|     |.      |:...:|
Human   278 HGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQ-----GLCLSCKKGRCNTLG 337

  Fly   380 LQIDYDLRGD---YILEVNAKSPF 400
            ..:..:.|..   ..|...|:|||
Human   338 YHVRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 81/347 (23%)
Abhydrolase <215..396 CDD:304388 61/219 (28%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.